Sports Teachers
GS Shetty International School · Mumbai · onsite · Posted today
Undisclosed5–10 yrsfulltimeSourced from
About a minute. You'll make an account on the way through.
About this role
- Develop and implement engaging lesson plans to teach accounting principles and practices.
- Evaluate student progress and provide constructive feedback to improve understanding.
- Create a supportive learning environment that encourages questions and exploration of accounting concepts.
- Collaborate with other teachers to develop and implement curriculum changes.
- Prepare students for exams and assessments by providing guidance on study materials.
- Stay updated with new developments in accounting education and incorporate them into teaching practices.
Disclaimer: This job description has been sourced from a public domain and may have been modified by Naukri.com to improve clarity for our users. We encourage job seekers to verify all details directly with the employer via their official channels before
Sourced from naukri
Skills
mathematicsyogaexerciseteachingswimmingcricketgymathleticsphysical trainingphysical educationBadmintonTrainingbasketballvolleyballComputerSportsFootballCoaching
About GS Shetty International School
GS Shetty International School
Education & Training
175
employees
₹4.2L PA avg
Avg at GS Shetty International School
About
GS Shetty International School focuses on providing quality education through the ICSE curriculum. The school aims to develop students' academic and personal skills, preparing them for future challenges. It emphasizes a holistic approach to learning, fostering creativity and critical thinking.
Industries
Education & Training
Employee ratings
10 reviews
4.2/ 5
Culture
4.4
Career growth
4.2
Work-life
4.2
Employees rate it well for
Overall Company42Company Culture41
Find them on